PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim12g011240.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 240aa    MW: 27253.1 Da    PI: 6.3957
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim12g011240.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like491.3e-15110163255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+ Wt++LH++Fv +v+  GG+ +  P++il+ m   g++  ++k  LQ YR 
  Sopim12g011240.0.1 110 PRMLWTEDLHRKFVAVVDAYGGPWVVKPRHILKEMTHLGISHCQIKNRLQSYRA 163
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.3E-10107166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-13108165IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-12110164IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MFPLSPSPVV EIGNFQSPII PTMQLHYDEL MSLQQSQFYY QPVNDFSFLE NHGPMRLFGE  60
QNIINNNVVS YQDPFMLNPN VLNFNVAHQV QQELGQQPNN VGSTSRVKPP RMLWTEDLHR  120
KFVAVVDAYG GPWVVKPRHI LKEMTHLGIS HCQIKNRLQS YRAKLNPNDA GGRKCKASSK  180
KELIQDVQEQ LKNVDGGKAD DDVCIPQLPT EAEKTKAQIS PEDAFIEELL NWMVVKQDI*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015060088.11e-130PREDICTED: protein PHR1-LIKE 1-like
TrEMBLK4DCL01e-180K4DCL0_SOLLC; Uncharacterized protein
STRINGSolyc12g011240.1.11e-179(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14605411
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-11G2-like family protein